MaxLight™405 is a new Violet photostable dye conjugate comparable to Alexa Fluor® 405, PacificBlue™, Brilliant™ Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection.
Oncostatin M Receptor beta (OSM Rb) is a type I transmembrane protein that binds OSM with low affinity by itself and high affinity as an OSM Rb/gp130 heterodimer.
OSM Rb is widely expressed and transduces signals involved in hematopoiesis, liver development, peripheral neuron repair and epithelial cell function.
Mature human OSM Rb contains a 712aa extracellular domain (ECD) with one partial and one complete hematopoietin domain, an Ig-like domain and three fibronectin type-III domains, a 22aa transmembrane segment, and a 218aa cytoplasmic domain.
Human OSM Rb ECD shares 55% aa sequence identity with mouse OSM Rb.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™405 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™405.
Specificity:Recognizes human OSMR. Species Crossreactivity: mouse.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo
Immunogen:Full length human OSMR, aa1-342 (AAH10943.1)