84-2780-65 [取扱停止]NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) (MaxLight 405) 100ul 130295-ML405
84-2780-65 [取扱停止]NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) (MaxLight 405) 100ul 130295-ML405
MaxLight™405 is a new Violet photostable dye conjugate comparable to Alexa Fluor® 405, PacificBlue™, Brilliant™ Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection.
This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain.
It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.
Alternatively spliced transcript variants have been observed, but they have not been fully characterized.
[provided by RefSeq].
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™405 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™405.
Specificity:Recognizes human NETO2.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human NETO2, aa1-148 (AAH12381.1).