84-2776-28　［取扱停止］IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2a, Interferon-induced Protein 17, Interferon-inducible Protein 9-27, Leu-13 Antigen) (MaxLight 405) 100ul　128253-ML405

特徴

• MaxLight™405 is a new Violet photostable dye conjugate comparable to Alexa Fluor® 405, PacificBlue™, Brilliant™ Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection.
• Absorbance (400nm); Emission (423nm); Extinction Coefficient 32,000.
• IFN-induced antiviral protein that mediate cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus, and dengue virus by inhibiting the early step(s) of replication.
• Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activition or by arresting cell growth in G1 phase in a p53-dependent manner.
• Implicated in the control of cell growth.
• Component of a multimeric complex involved in the transduction of antiproliferative and homotypic adhesion signals.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA sequence:MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: MaxLight™405 conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.