84-2646-39　［取扱停止］TNNT1 (Troponin T Type 1 (Skeletal, slow), ANM, FLJ98147, MGC104241, STNT, TNT, TNTS) (AP) 100ul　252859-AP

特徴

• This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere.
• This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration.
• This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit.
• This protein is the slow skeletal troponin T subunit.
• Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year.
• Multiple transcript variants encoding different isoforms have been found for this gene.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
• Storage and Stability:Store product at 4°C.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note:Applications are based on unconjugated antibody.
• Note: Applications are based on unconjugated antibody.