The protein encoded by this gene is found in the nucleoli.
It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins.
Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor.
This protein is thought to be required for RNA transcription.
This gene has been shown to be amplified in tumors.
[provided by RefSeq
Applications:Suitable for use in Immunofluorescence, Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a liquid in PBS, pH 7.4.
Specificity:Recognizes human YEATS4.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:YEATS4 (NP_006521.1, 1aa-227aa) full-length human protein.