The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family.
This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells.
The expression of this protein is inducible by TNF and IL-1 alpha.
This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6.
It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells.
This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor.
An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.
[provided by RefSeq
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a liquid in PBS, pH 7.4.
Specificity:Recognizes human TNFSF15.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:TNFSF15 (NP_005109.2, 1aa-251aa) full-length human protein.