The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase.
The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B).
Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis.
Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses.
[provided by RefSeq
Applications:Suitable for use in Immunofluorescence, Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:mouse
Source Antibody:human
Grade:Ascites
Purity:Ascites
Form:Supplied as a liquid. No preservative added.
Specificity:Recognizes human PTGES.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:PTGES (NP_004869.1, 1aa-152aa) full-length human protein.