84-2624-77　OLIG2 (Oligodendrocyte Lineage Transcription Factor 2, BHLHB1, OLIGO2, PRKCBP2, RACK17, bHLHe19) 50ug　249594

特徴

• This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain.
• The protein is an essential regulator of ventral neuroectodermal progenitor cell fate.
• The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia.
• Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPVDKLGGSGFKSSSSSTSSSTSSMouse polyclonal antibody raised against a full-length human OLIG2 protein.SSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPMouse polyclonal antibody raised against a full-length human OLIG2 protein.AHAAHHPAVHHPILPPMouse polyclonal antibody raised against a full-length human OLIG2 protein.Mouse polyclonal antibody raised against a full-length human OLIG2 protein.Mouse polyclonal antibody raised against a full-length human OLIG2 protein.Mouse polyclonal antibody raised against a full-length human OLIG2 protein.AVSSASLPGSGLPSVGSIRPPHGLLKSPSMouse polyclonal antibody raised against a full-length human OLIG2 protein.AAPLGGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.