The protein encoded by this gene is a member of the interleukin 1 cytokine family.
This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses.
This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2.
A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer.
Four alternatively spliced transcript variants encoding distinct isoforms have been reported.
[provided by RefSeq
Applications:Suitable for use in Western Blot, Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a liquid. No preservative added.
Specificity:Recognizes human IL1RN.
Isotype:IgG
Calc Applications Abbrev:IP WB
Calc Crossreactivity:Hu
Immunogen:IL1RN (NP_776214.1, 1aa-177aa) full-length human protein.