This intronless gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain.
The specific function of this gene has not yet been determined; however, it may play a role in tumor formation.
[provided by RefSeq
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTLSTEMSDASGLAEETDIDVVGEGEDEEDEEEEDDDEGGGGGPRLAVPAQRRRRRRSYAGEDELEDLEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNMouse polyclonal antibody raised against a full-length human FOXD1 protein.AESLLLRGAGAAGGAGDPMouse polyclonal antibody raised against a full-length human FOXD1 protein.AALFPPAPPPPPHAYGYGPYGCGYGLQLPPYAPPSALFMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.AAFHPHSPPPPPPPHGMouse polyclonal antibody raised against a full-length human FOXD1 protein.ELARTAFGYRPHPLGAALPGPLPASAAKAGGPGASALARSPFSIESIIGGSLGPMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.AAQMouse polyclonal antibody raised against a full-length human FOXD1 protein.AAQASPSPSPVAAPPAPGSSGGGCAAQAAVGPMouse polyclonal antibody raised against a full-length human FOXD1 protein.LTRSLVMouse polyclonal antibody raised against a full-length human FOXD1 protein.Mouse polyclonal antibody raised against a full-length human FOXD1 protein.ASSVSSSAALGTLHQGTALSSVENFTARISNC
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Purified
Purity:Purified
Form:Supplied as a liquid in PBS, pH 7.4.
Specificity:Recognizes human FOXD1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:FOXD1 (AAI60026.1, 1aa-465aa) full-length human protein.