Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors.
Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis.
Chemokines are divided into 2 major subfamilies, CXC and CC.
This gene is a CXC member of the chemokine superfamily.
Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3.
The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression.
IFN-gamma is a potent inducer of transcription of this gene.
[provided by RefSeq.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ul
Host：mouse
Source Antibody：human
Grade：Ascites
Purity：Ascites
Form：Supplied as a liquid. No preservative added.
Specificity：Recognizes human CXCL11.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：CXCL11 (AAH05292, 1aa-94aa) full-length human protein.
