The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family.
Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains.
The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
This encoded protein is a cell surface glycoprotein that is known to complex with integrins.
It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation.
Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses.
Alternative splicing results in multiple transcript variants encoding the same protein.
[provided by RefSeq
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:mouse
Source Antibody:human
Grade:Ascites
Purity:Ascites
Form:Supplied as a liquid. No preservative added.
Specificity:Recognizes human CD53.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:CD53 (NP_000551.1, 1aa-219aa) full-length human protein.