84-2599-99　CCL13 (Chemokine (C-C Motif) Ligand 13, CKb10, MCP-4, MGC17134, NCC-1, NCC1, SCYA13, SCYL1) 50ul　244297

特徴

• This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17.
• Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes.
• The CC cytokines are proteins characterized by two adjacent cysteines.
• The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils.
• This chemokine plays a role in accumulation of leukocytes during inflammation.
• It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.
• [provided by RefSeq
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.