This gene encodes a major constituent of the human complement subcomponent C1q.
C1q associates with C1r and C1s in order to yield the first component of the serum complement system.
A deficiency in C1q has been associated with lupus erythematosus and glomerulonephritis.
C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains.
Each chain contains a collagen-like region located near the N-terminus, and a C-terminal globular region.
The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1.
This gene encodes the C-chain polypeptide of human complement subcomponent C1q.
Alternatively spliced transcript variants that encode the same protein have been found for this gene.
[provided by RefSeq
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Purified
Purity：Purified
Form：Supplied as a liquid in PBS, pH 7.4.
Specificity：Recognizes human C1QC.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：C1QC (NP_758957.2, 1aa-245aa) full-length human protein.
