e range of cell surface receptors, participating in the regulation of cell survival, proliferation, differentiation and stress responses.
TRAF-associated NF- B activator (TANK), also known as TRAF-interacting protein (I-TRAF), is a TRAF binding protein that demonstrates both stimulatory and inhibitory properties (5,6).
TANK binds to the carboxy domain of the TRAF1, -2 and -3.
Overexpression of TANK prevents the association of TRAF2 with TNFR2, inhibiting TNFR2 and CD40 induced NF- B activation (6).
TANK is also reported to synergize with low levels of TRAF2 to activate NF- B (5).
TANK assists in the activation of NF- B via association and activation of TANK-binding kinase 1 (TBK1) or IKK which promotes activation of the IKK complex (7,8).
It has also been shown that TANK may synergize with TRAF2, TRAF5, and TRAF6 but not TRAF3 in SAPK activation (9).
TNF stimulation results in IKK -dependent phosphorylation of TANK which may provide negative feedback regulation of TANK mediated NF- B activation (10).
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: PE conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Specificity:Recognizes human TANK.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human TANK, aa1-119 (NP_597841.1).