84-2579-27　NUDT2 (Nudix-type Motif 2, APAH1, Bis(5'-nucleosyl)-tetraphosphatase [Asymmetrical], Diadenosine 5',5'''-P1,P4-tetraphosphate Asymmetrical Hydrolase, Diadenosine Tetraphosphatase, Ap4A Hydrolase, Ap4Aase, Nucleoside Diphosphate-linked Moiety X Motif 2) (PE) 100ul　130630-PE

特徴

• This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family.
• The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases.
• The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established.
• This gene may be a candidate tumor suppressor gene.
• Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: PE conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.