B cell-activating factor receptor (BAFF-R) is a 19kD type III membrane protein.
It belongs to the TNFR superfamily also known as TNFRSF member 13C (TNFRSF13C), BAFF receptor 3 (BR3), or CD268.
BAFF-R is expressed on mature B cells, B cell lymphoma, and T cell subset.
BAFF-R is the major receptor for BAFF/BLys (or TALL-1, THANK), which binds to TACI and BCMA as well.
The interaction of BAFF with BAFF-R promotes NF-k B activation and plays a major role in B-cell maturation and survival, as well as costimulates T cell activation and proliferation.
TRAF3 is a BAFF-R intracellularly associated protein, which negatively regulates BAFF-R-mediated NF-k B activation.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: PE conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Specificity：Recognizes human BAFF Receptor. Species Crossreactivity: mouse
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length protein corresponding to aa 1-184 from human BAFF Receptor.
