84-2552-25　POLR2L (DNA-directed RNA Polymerases I, II, and III Subunit RPABC5, RNA Polymerases I, II, and III Subunit ABC5, DNA-directed RNA Polymerase III Subunit L, RNA Polymerase II 7.6kD Subunit, RPB7.6, RPB10 Homolog) (HRP) 100ul　131593-HRP

特徴

• DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
• Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
• Pol II is the central component of the basal RNA polymerase II transcription machinery.
• Pols are composed of mobile elements that move relative to each other.
• In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.