84-2549-01　NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13, Cell Death Regulatory Protein GRIM-19, Complex I-B16.6, CI-B16.6, Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein, GRIM-19, Gene Associated with Retinoic and IFN-induced Mortality 19 Protein, NADH-ubiquinone Oxidoreductase B16.6 Subunit, GRIM19, CDA016, CGI-39) (HRP) 100ul　130209-HRP

特徴

• Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.
• Complex I functions in the transfer of electrons from NADH to the respiratory chain.
• The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death.
• This apoptotic activity is inhibited by interaction with viral IRF1.
• Prevents the transactivation of STAT3 target genes.
• May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.