Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner.
As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites.
CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions.
Latrophilin-1 has been reported to be expressed predominantly in the brain.
Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas.
ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries.
In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Specificity：Recognizes human LPHN1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human LPHN1, aa1-201 (AAH19928.1).
