84-2544-69　ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2) (HRP) 100ul　128190-HRP

特徴

• Involved in cell adhesion.
• There are 4 isoforms produced by alternative splicing.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHSELPGQMDARCWGRERGLPLGAALMEDTPTPSLRISWNFRLLPLYYTEVILFF
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.