Folate receptor 1 (FOLR1; also folate receptor alpha, folate binding protein 1, and MOv18) is a 37-42kD member of the folate receptor family.
FOLR1 is expressed in reticulocytes and placenta, plus renal, mammary, and thymic epithelium, where it mediates the transport of 5-methyltetrahydrofolate into the cell.
The human FOLR1 preproprecursor is 257aa in length.
It codes for a GPI-linked glycoprotein that is 210aa in size (aa25-234).
There are two forms of FOLR1.
One is GPI-linked, while the other is a soluble MMP cleavage product (aa25-226).
There is one potential alternate splice form that shows a five aa substitution for aa121-205.
Over aa25-233, human FOLR1 shares 83% aa identity with mouse FOLR1.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Specificity：Recognizes human FOLR1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human FOLR1, aa1-257 (NP_000793.1).
