84-2534-55　BAFF Receptor (BAFFR, BAFF-R, B Cell-activating Factor Receptor, BLyS Receptor 3, BR3, BROMIX, CD268, CVID4, MGC138235, Prolixin, Tumor Necrosis Factor Receptor Superfamily Member 13C, TNFRSF13C) (HRP) 100ul　123803-HRP

特徴

• B cell-activating factor receptor (BAFF-R) is a 19kD type III membrane protein.
• It belongs to the TNFR superfamily also known as TNFRSF member 13C (TNFRSF13C), BAFF receptor 3 (BR3), or CD268.
• BAFF-R is expressed on mature B cells, B cell lymphoma, and T cell subset.
• BAFF-R is the major receptor for BAFF/BLys (or TALL-1, THANK), which binds to TACI and BCMA as well.
• The interaction of BAFF with BAFF-R promotes NF-k B activation and plays a major role in B-cell maturation and survival, as well as costimulates T cell activation and proliferation.
• TRAF3 is a BAFF-R intracellularly associated protein, which negatively regulates BAFF-R-mediated NF-k B activation.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.