Beta-arrestin 1 is a 418aa containing signaling neurotransmitter that belongs to the arrestin family with an arrestin N-terminal and an arrestin C-terminal domain.
A regulator of beta-adrenergic receptor function, Beta-arrestin 1 seems to bind to phosphorylated beta-adrenergic receptors, thereby causing a significant impairment of their capacity to activate G(S) proteins.
It is also reported to act as an activator of the lymphoid enhancer factor (LEF) transcription factor.
Beta-arrestin 1 plays a crucial role in ubiquitination and down-regulation of the insulin-like growth factor-1 receptor by acting as an adaptor for the MDM2 E3 ligase.
Purified beta-arrestin inhibits the signaling function of BARK-phosphorylated beta-adrenergic receptors by more than 75%, but not that of rhodopsin, and is also involved in synaptic transmission in photoreceptor cells.
It is widely expressed in most tissues.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Specificity：Recognizes human ARRB1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human ARRB1, aa1-418 (NP_004032.2).
