84-2533-73　APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2) (HRP) 100ul　123406-HRP

特徴

• Apolipoprotein A2 (ApoA2) is a major protein component of serum HDL.
• It is produced by the liver and is involved in cholesteryl ester formation and cholesterol transport from tissues to the liver.
• Polymorphisms of ApoA2 are associated with disorders of cholesterol and fatty acid metabolism.
• ApoA2 can form disulfide-linked 17kD homodimers and heterodimers with other apolipoproteins.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.