84-2533-71　APLN (Apelin, XNPEP2, APJ Endogenous Ligand, APEL) (HRP) 100ul　123401-HRP

特徴

• Endogenous ligand for APJ, an alternative coreceptor with CD4 for HIV-1 infection.
• Inhibits HIV-1 entry in cells coexpressing CD4 and APJ.
• Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives.
• The oral intake in the colostrum and the milk could have a role in the modulation of the immune responses in neonates.
• May also have a role in the central control of body fluid homeostasis by influencing AVP release and drinking behavior.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilutions:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.