84-2533-07　AKR1C1 (Aldo-keto Reductase Family 1 Member C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, Chlordecone Reductase Homolog HAKRC, Dihydrodiol Dehydrogenase 1/2, DD1/DD2, High-affinity Hepatic Bile Acid-binding Protein, HBAB, Indanol Dehydrogenase, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, DDH, DDH1) (HRP) 100ul　123158-HRP

特徴

• The human aldo-keto reductases 1C1 and 1C3 (AKR1C1 and AKR1C3) have major roles in pre receptor regulation of progesterone action.
• They can both convert progesterone to the less potent efficiencies.
• AKR1C1 and AKR1C3 also act as 3-ketosteroid reductase, and as such they can convert the most potent androgen 5alpha-DHT into 3beta-andorstandiol, which is an estrogen receptor beta ligand, and into the inactive androgen 3alpha-androstnionl, respectively.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.