a1-Acid Glycoprotein (AGP; also OMD/Orosomucoid) is a 40-46kD member of the immunocalin subfamily, lipocalin family of molecules.
In mouse, circulating AGP is principally the product of hepatocytes that originates from multiple related genes (AGP-1, -2 and -3 in Mus musculus).
Circulating AGP-1 and -2 are both 189aa in length, the principal sources of protein, and show 83% aa identity; AGP-3 contributes little to the AGP pool.
In mouse blood, AGP is normally 200-400ug/ml.
In response to inflammatory mediators (IL-6; IL-1), its concentration will rise 2-10 fold.
More importantly, a complex glycosylation pattern will also change, transitioning from modestly branched to highly branched oligosaccharides.
This change is reflected in its bioactivity, which has been shown to be a function of carbohydrate branching.
AGP is generally considered to be a suppressor of inflammation.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Specificity:Recognizes human ORM1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human ORM1, aa1-201 (NP_000598.1).