84-2525-80　S100A2 (S100L, CaN19, Protein S100-A2, Protein S-100L, S100 Calcium-binding Protein A2) (FITC) 100ul　132919-FITC

特徴

• S100A2 is a 10kD member of the S100 family, EF-hand superfamily of Ca-binding proteins.
• It is expressed by multiple cell types, including keratinocytes, chondrocytes, and bronchial epithelium.
• S100A2 regulates both Ca and Zn (in human) within cells, and increases p53 activity.
• It forms both noncovalent and covalent homodimers, and a homotetramer under certain conditions.
• Human S100A2 is 98aa in length.
• It contains two EF-hand motifs (aa13-48 and 51-86) plus a calcium (aa64-75) and zinc (aa17-22) binding site.
• There is one potential alternative splice form that shows a 40aa insertion after Gly48.
• Full-length human S100A2 shares 89%, 85% aa identity with bovine and canine S100A2, respectively.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP*
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: FITC conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.