RGS proteins are regulatory and structural components GPCR complexes.
These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways.
RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP.
It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain.
RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure.
It specifically interacts and accelerates the hydrolysis of G-alphaz.
Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling.
It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Specificity:Recognizes human RGS20. Species Crossreactivity: mouse.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo
Immunogen:Full length human RGS20, aa1-241 (NP_003693.2).