Glutamine Synthetase catalyzes the conversion of ammonia and glutamate to glutamine.
This reaction consumes a molecule of ATP:Glutamate + NH4+ + ATP , and produces, Glutamine + ADP + Pi.
It is found in astrocytes as an octamer of identical 45kD subunits.
The function of Glutamine Synthetase is the detoxification of brain ammonia.
It also has an important role in controlling metabolic regulations of neurotransmitter glutamate.
Because of the multiple functions and importance of Glutamine Synthetase in cellular metabolism, both catalytic activities and synthesis are highly regulated.
The activity of Glutamine Synthetase is controlled by adenylylation.
Its activity is decreased in the cerebral cortex of brains affected by Alzheimer's disease, particularly in the vicinity of senile plaques.
It is also decreased under conditions of glucose deprivation.
On the other hands, the level of expression of Glutamine Synthetase is increased during ischemia in vivo or hypoxia in culture.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Specificity:Recognizes human GLUL. Species Crossreactivity: mouse.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo
Immunogen:Full length human GLUL, aa1-373 (NP_002056.2).