84-2503-87 AKR1C3 (DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto Reductase Family 1 Member C3, 17-beta-hydroxysteroid Dehydrogenase Type 5, 3-alpha-HSD Type II, Brain, 3-alpha-hydroxysteroid Dehydrogenase Type 2, Chlordecone Reductase Homolog HAKRb, Dihydrodiol Dehydrogenase 3, Dihydrodiol Dehydrogenase Type I, HA1753, Indanol Dehydrogenase, Prostaglandin F Synthase, Testosterone ... 123164-FITC
84-2503-87 AKR1C3 (DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto Reductase Family 1 Member C3, 17-beta-hydroxysteroid Dehydrogenase Type 5, 3-alpha-HSD Type II, Brain, 3-alpha-hydroxysteroid Dehydrogenase Type 2, Chlordecone Reductase Homolog HAKRb, Dihydrodiol Dehydrogenase 3, Dihydrodiol Dehydrogenase Type I, HA1753, Indanol Dehydrogenase, Prostaglandin F Synthase, Testosterone ... 123164-FITC
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins.
These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors.
The enzymes display overlapping but distinct substrate specificity.
This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2.
It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation.
This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Specificity:Recognizes human AKR1C3.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human AKR1C3, aa1-323 (NP_003730.4).
Shelf Life:1year
EU Commodity Code:30021010
商品名:AKR1C3 (DDH1, HSD17B5, KIAA0119, PGFS, Aldo-keto Reductase Family 1 Member C3, 17-beta-hydroxysteroid Dehydrogenase Type 5, 3-alpha-HSD Type II, Brain, 3-alpha-hydroxysteroid Dehydrogenase Type 2, Chlordecone Reductase Homolog HAKRb, Dihydrodiol Dehydrogenase 3, Dihydrodiol Dehydrogenase Type I, HA1753, Indanol Dehydrogenase, Prostaglandin F Synthase, Testosterone 17-beta-dehydrogenase 5, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase) (FITC) 100ul