84-2502-34　Amylin (DAP, Diabetes-Associated Peptide, IAP, Islet Amyloid Polypeptide, Insulinoma Amyloid Peptide, IAPP) (FITC) 100ul　A2275-52Z-FITC

特徴

• Amylin is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma.
• While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish.
• Recent results suggest that amylin, like the related beta amyloid (Abeta) assosciated with Alzheimer's disease, can induce apoptotic cell death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: Transfected 293T cellsOptimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: FITC conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
• Note: Applications are based on unconjugated antibody.