The UBL4 gene lies in a ubiquitiously transcribed region on the X chromosome approximately 40kb downstream of glucose-6-phosphate dehydrogenase (G6PD).
The UBL4 gene, which encodes for a 157aa protein, is consistent with the characteristics of a housekeeping gene, since transcripts are detected a multiple cell types, and the protomoter region is rich in GC sequences and lacks signals such as TATA and CAT boxes.
The UBL4 protein bears strong similarity in its 72 N-terminal aa to ubiquitin.
In the middle of the C-terminus moiety of the UBL4 protein, similarities to the thyroglobulin hormonogenic site, the sequence that surrounds the tyrosines that will form thyroxine, have been demonstrated.
It has been inferred from these data that the UBL4 protein plays an important role in essential cellular functions.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity：Recognizes human UBL4A.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human UBL4A, aa1-157 (NP_055050.1).
