84-2497-73 SMAC (Diablo Homolog, Mitochondrial, Second Mitochondria-derived Activator Of Caspase, Smac, Direct IAP-binding Protein With Low pI, DIABLO, FLJ10537, FLJ25049) (Biotin) 100ul 133533-Biotin
84-2497-73 SMAC (Diablo Homolog, Mitochondrial, Second Mitochondria-derived Activator Of Caspase, Smac, Direct IAP-binding Protein With Low pI, DIABLO, FLJ10537, FLJ25049) (Biotin) 100ul 133533-Biotin
Second mitochondria-derived activator of caspase (SMAC) has been implicated in the activation of apoptosis in response to cell stress.
SMAC promotes CASP9 activation by binding to IAPs and removing their inhibitory activity.
The inhibitor of apoptosis proteins (IAPs) regulate programmed cell death by inhibiting members of the caspase family of enzymes.
Smac/DIABLO is a mitochondrial protein that is released along with cytochrome c during apoptosis and activates cytochrome c/Apaf-1/caspase-9 pathway.
Smac is an antagonist of the X-linked inhibitor of apoptosis (XIAP) - the most potent caspase inhibitor of all known inhibitor of apoptosis-family members.
Smac promotes apoptosis by eliminating the inhibitory effect of inhibitor-of-apoptosis (IAPs) through physical interactions.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity:Recognizes human DIABLO.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human DIABLO, aa1-239 (NP_063940.1).