Serpin B8 is a 42-45kD, cytoplasmic and secreted member of the ovalbumin (clade B)-subfamily, Serpin superfamily of protease inhibitors.
It is produced by multiple cell types and shows inhibitory activity towards furin and possibly other proteinases such as chymotrypsin.
Mouse Serpin B8 is 374aa in length.
Although it has no signal sequence, it is likely to be released by platelets.
The active inhibitory site lies between Arg336 and Arg342.
One potential isoform shows a 4aa substitution for the C-terminal 133aa.
Full length mouse Serpin B8 shares 78% and 91% aa identity with human and rat Serpin B8, respectively.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity：Recognizes human SERPINB8.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human SERPINB8, aa1-242 (NP_001027018.1).
