84-2497-01　SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (Biotin) 100ul　133125-Biotin

特徴

• This gene is a member of the septin family of GTPases.
• Members of this family are required for cytokinesis.
• This gene encodes a protein associated with the tau-based paired helical filament core, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease.
• SEPT2, otherwise known as septin-2, is a cytoskeletal GTPase and member of the septin family, essential for the formation of filaments, in conjunction with SEPT6 and SEPT7.
• SEPT2 plays an important role during mitosis progression/cytokinesis, in the correct organization of the actin cytoskeleton, and maintains polyGlu microtubule tracks, thereby facilitating epithelial cell vesicle transport.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 
• Note: Applications are based on unconjugated antibody.