S100A2 is a 10kD member of the S100 family, EF-hand superfamily of Ca-binding proteins.
It is expressed by multiple cell types, including keratinocytes, chondrocytes, and bronchial epithelium.
S100A2 regulates both Ca and Zn (in human) within cells, and increases p53 activity.
It forms both noncovalent and covalent homodimers, and a homotetramer under certain conditions.
Human S100A2 is 98aa in length.
It contains two EF-hand motifs (aa13-48 and 51-86) plus a calcium (aa64-75) and zinc (aa17-22) binding site.
There is one potential alternative splice form that shows a 40aa insertion after Gly48.
Full-length human S100A2 shares 89%, 85% aa identity with bovine and canine S100A2, respectively.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP*
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity：Recognizes human S100A2. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human S100A2, aa1-98 (AAH02829).
