RGS proteins are regulatory and structural components GPCR complexes.
These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways.
RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP.
It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain.
RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure.
It specifically interacts and accelerates the hydrolysis of G-alphaz.
Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling.
It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity:Recognizes human RGS20. Species Crossreactivity: mouse.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo
Immunogen:Full length human RGS20, aa1-241 (NP_003693.2).