84-2490-65　NDUFB7 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 7, NADH-Ubiquinone Oxidoreductase B18 Subunit, Complex I-B18, CI-B18, Cell Adhesion Protein SQM1, MGC2480) (Biotin) 100ul　130230-Biotin

特徴

• The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I).
• Mammalian complex I is composed of 45 different subunits.
• It is located at the mitochondrial inner membrane.
• This protein has NADH dehydrogenase activity and oxidoreductase activity.
• It transfers electrons from NADH to the respiratory chain.
• The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• [provided by RefSeq]
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 
• Note: Applications are based on unconjugated antibody.