84-2489-98　MSI1 (Musashi-1, Musashi 1, RNA-binding Protein Musashi Homolog 1) (Biotin) 100ul　129923-Biotin

特徴

• Musashi 1, a neural RNA-binding protein, plays an important role in regulating cell differentiation in precursor cells.
• Musashi 1 (Msi-1) has been shown to increase the accumulation of tau isoforms in intracellular inclusions in dementia and Parkinson's.
• The presence of Msi-1 in a significant percentage of neurons containing cytoplasmic inclusions in 2 other neurodegenerative diseases Alzheimer's disease and Pick disease suggests that it may play a role in the pathogenesis of these neurodegenerative disorders.
• Musashi 1 has also been detected in human tumor tissues such as gliomas and melanomas, suggesting its involvement in cancer development.
• Msi-1 also appears to play be an vital role in the development of several types of carcinoma such as human hepatoma, and may be a useful molecular marker for tumor detection.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 
• Note: Applications are based on unconjugated antibody.