Defensins are a large family of broad-spectrum antimicrobial peptides, identified originally in leukocytes of rabbits and humans.
The genes encoding alpha human beta and defensins are clustered in a contiguous segment of chromosome 8p23.
Defensins are initially synthesized as inactive prodefensins with a signal peptide that is cleaved off by Matrilysin/MMP7 (a tissue metalloproteinase) to generate mature and bioactive defensin peptide.
Matrilysin is expressed in Paneth cell granules together with perhaps more than 20 different -defensins (cryptidins).
Disruption of the matrilysin gene prevents the normal posttranslational proteolytic activation of intestinal prodefensins.
Matrix metalloproteinase-7 (MMP-7) also known as matrilysin and PUMP (EC 3.4.24.23) cleaves a number of substrates including collagen types IV and X, elastin, fibronectin, gelatin, laminin and proteoglycans.
MMP-7 is closely related to the stromelysin family members but is encoded by a different gene.
MMP-7 is the smallest of all the MMPs consisting of a pro-peptide domain and a catalytic domain.
It lacks the hemopexin-like domain common to other members of the MMPs.
MMP-7 is secreted as a 28kD proenzyme and can be activated in vitro by organomercurials and trypsin and in vivo by MMP-3 to a 18kD active MMP-7 enzyme.
Once activated, MMP-7 can activate pro-MMP-1 and pro-MMP-9 but not pro-MMP-2.
MMP-7 is widely expressed having been reported in elevated levels in cycling endometrium as well as in colorectal cancers and adenomas, hepatocellular carcinomas, rectal carcinomas, and approximately 50% of gliomas.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity：Recognizes human MMP7.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human MMP7, aa1-267 (NP_002414.1).
