84-2487-83 KIRREL2 (Kin of IRRE-like Protein 2, Kin of Irregular Chiasm-like Protein 2, Nephrin-like Protein 3, NEPH3, UNQ5827/PRO19646, DKFZp564A1164, MGC15718) (Biotin) 100ul 128838-Biotin
84-2487-83 KIRREL2 (Kin of IRRE-like Protein 2, Kin of Irregular Chiasm-like Protein 2, Nephrin-like Protein 3, NEPH3, UNQ5827/PRO19646, DKFZp564A1164, MGC15718) (Biotin) 100ul 128838-Biotin
Interacts with NPHS2/podocin (via the C-terminus).
Interacts with NPHS1 (via the Ig-like domains).
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MLRMRVPALLVLLFCFRGRAGPSPHFLQQPEDLVVLLGEGGAQASLGRRASASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity：Recognizes human KIRREL2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human KIRREL2, aa1-219 (AAH07312.1).
