Interleukin 24 (IL-24), also known as mda-7 (melanoma differentiation associated gene-7), is a newly discovered member of the IL-10 family of helical cytokines.
The IL-24 gene encodes a precursor protein of 207 amino acids (aa) that contains a 48 aa signal sequence and an 18kD, 158 aa mature segment.
There are three potential N-linked glycosylation sites, at least one of which is used.
When secreted, IL-24 is a 35-40kD phosphorylated glycoprotein that apparently can exist as either a monomer or dimer.
It is suggested that glycosylation is essential for activity.
Mature human IL-24 shares 69% aa sequence identity with mouse and rat IL-24.
Human IL-24 is active in rodent systems.
Cells known to express IL-24 include B cells, CD4+ T cells, NK cells, lymph node dendritic cells, monocytes, melanocytes, and melanoma cells.
Functionally, IL-24 has diverse activities.
At low concentrations on monocytes, it induces type I proinflammatory cytokines such as IFN-gamma, IL-1Beta, IL-12 and TNF-alpha.
At high concentrations, it is a strong inducer of apoptosis in tumor cells, but not in normal cells.
IL-24 also has anti-angiogenic properties.
It binds directly to IL-24 receptors on endothelial cells, activating STAT3 and blocking their differentiation.
IL-24 binds and signals through two heterodimeric receptor complexes.
One complex is the combination of IL-20 Ralpha.
and IL-20 RBeta, which is shared with IL-19 and IL-20.
The second complex is a combination of IL-22 R and IL-20 RBeta, which is shared with IL-20.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity：Recognizes human IL24.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human IL24, aa1-206 (NP_006841.1).
