84-2486-45　IFITM1 (CD225, IFI17, Interferon-induced Transmembrane Protein 1, Dispanin Subfamily A Member 2a, Interferon-induced Protein 17, Interferon-inducible Protein 9-27, Leu-13 Antigen) (Biotin) 100ul　128253-Biotin

特徴

• IFN-induced antiviral protein that mediate cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus, and dengue virus by inhibiting the early step(s) of replication.
• Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activition or by arresting cell growth in G1 phase in a p53-dependent manner.
• Implicated in the control of cell growth.
• Component of a multimeric complex involved in the transduction of antiproliferative and homotypic adhesion signals.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA sequence:MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 
• Note: Applications are based on unconjugated antibody.