84-2485-14　HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II, AB-binding Alcohol Dehydrogenase, ABAD, CAMR, DUPXp11.22, ERAB, HCD2, HSD17B10, MHBD, Mitochondrial Ribonuclease P Protein 2, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, Type II HADH, Type 10 17b-HSD, Type 10 17beta-hydroxysteroid Dehydrogenase, 17b-HSD10, XH98G2) (Biotin) 100ul　127709-Biotin

特徴

• HCD2 (Hydroxyacyl-Coenzyme A dehydrogenase) is a mitochondrial protein that catalyzes the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway.
• ERAB is characterized as a NAD+-dependent dehydrogenase that overexpressed in neurons affected with Alzheimer's disease.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
• Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
• For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
• Aliquots are stable at -20°C for 12 months after receipt.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 
• Note: Applications are based on unconjugated antibody.