Broad-specificity phosphohydrolase that dephosphorylates exogenous bioactive glycerolipids and sphingolipids.
Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG).
Pivotal regulator of lysophosphatidic acid (LPA) signaling in the cardiovascular system.
Major enzyme responsible of dephosphorylating LPA in platelets, which terminates signaling actions of LPA.
May control circulating, and possibly also regulate localized, LPA levels resulting from platelet activation.
It has little activity towards ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P).
The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P.
It's down-regulation may contribute to the development of colon adenocarcinoma.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: APC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide and a stabilizer. Labeled with Allophycocyanin (APC).
Specificity:Recognizes human PPAP2A.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human PPAP2A, aa1-284 (NP_003702.2).