KLRG1 (killer cell lectin-like receptor G1), is the mouse homolog of the rat mast cell function-associated antigen (MAFA).
It is expressed by activated CD8 T-cells and by a large proportion of natural killer (NK) cells.
It is not found in the spleen, thymus, lymph nodes, testis, brain or kidney and is not expressed on mast cell lines, bone-marrow-derived mast cells or peritoneal mast cells.
T-cells expressing KLRG1 have greatly reduced proliferation potential, but are not limited in their capacity to perform immediate effector cell functions, such as the secretion of gamma interferon.
KLRG1 plays an inhibitory role on NK cells and T-cells by binding to their ligands.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: APC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide and a stabilizer. Labeled with Allophycocyanin (APC).
Specificity:Recognizes human KLRG1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full-length human KLRG1, aa1-207 (NP_005801.3).