The ING1 (inhibitor of growth) tumor suppressor protein shares a number of biological functions that are very similar with p53.
The human ING1 gene contains three exons and two introns.
There are four alternative splice variants produced from three different promoter regions (p33 ING1, p24 ING1, p27 ING1, p47 ING1).
A number of studies have concluded that ING1 can influence a number of biological functions, which might be dependent on the variant that is expressed.
The ING1 family has been reported to mediate growth arrest, senescence, anchorage-dependent growth and apoptosis, as well as influence chemosensitivity.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: APC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide and a stabilizer. Labeled with Allophycocyanin (APC).
Specificity:Recognizes human ING1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human ING1, aa1-279 (NP_937862.1).