84-2449-70 Chromogranin A (CGA, CHG A, Pancreastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, Vasostatin, SPI) APC 100ul 124982-APC
84-2449-70 Chromogranin A (CGA, CHG A, Pancreastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, Vasostatin, SPI) APC 100ul 124982-APC
The prohormone chromogranin A (CgA) is a member of the chromogranin:secretogranin protein family of regulated secretory proteins, which are widely distributed in secretory granules of endocrine, neuroendocrine, and neuronal cells.
It is required for the formation of dense-core secretory granules and hormone sequestration in sympathoadrenal chromaffin cells.
It functions as prohormones, giving rise to bioactive peptides, vasostatin, pancreastatin, and parastatin as a result of post-translational proteolytic processing.
Peptides derived from chromogranin A have autocrine, paracrine, and endocrine activities.
It also inhibit secretion of proopiomelanocortin hormone.
Catestatin, another fragment of chromogranin A, inhibits the release of catecholamines from sympathoadrenal chromaffin cells by blocking the neuronal nicotinic cholinergic receptor, which is the physiologic trigger for secretion.
Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein.
It maps to 14q32 region of human chromosome.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: APC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide and a stabilizer. Labeled with Allophycocyanin (APC).
Specificity:Recognizes human CGA.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human CGA, aa1-116 (NP_000726.1).